PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02456.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GeBP
Protein Properties Length: 422aa    MW: 46211.4 Da    PI: 6.8942
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02456.1_g00009.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57379.74.5e-2558152297
                   DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqk 87 
                              +f+r+w+e Dei +LqGl+d  +++      d++ fy  +++ +s  ++ksql+eK+rrL+kKf+  +++ ++g ++s+ ++hd  
  Sme2.5_02456.1_g00009.1  58 KFHRIWTEPDEIRFLQGLLDGSSENL-FFPRDLNVFYTRFSNAMSQPYTKSQLSEKLRRLRKKFRVISSRLAKGLDMSLLSPHDLA 142
                              699******************77776.4456******************************************************* PP

                   DUF573  88 ifelskkiWg 97 
                               ++lsk++W+
  Sme2.5_02456.1_g00009.1 143 LYDLSKQLWH 152
                              *********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-2759152IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MDSTPSLSQS PNQPLLPSSS KLPIKRKTPN DPFISAGDGD GDGGVGEMGS DPKHPPFKFH  60
RIWTEPDEIR FLQGLLDGSS ENLFFPRDLN VFYTRFSNAM SQPYTKSQLS EKLRRLRKKF  120
RVISSRLAKG LDMSLLSPHD LALYDLSKQL WHPYFADTSP FNAADKSKKS NLVGVKVSFL  180
PNIPDPDQYG IVPYQDGNGS TRNGVSGENG VFDDGDGKLS EVNVELDRGE MEEKLVDFSR  240
LDGPVQVGVG VGDIAAKVVM DVFDECLKDF RNGVGERSNL GVILKEASSD EFEERWKEQR  300
VAELNVLARR MRPSPMSTGH LCHLPGSLRT YPYDFLGILR QTPMQPQNSW ANTQRKPSKL  360
PVSVNAVGSP GPLARLVVDT HASVDAAMPP GPLVRLVANP LASANAVRPP GLLAGLVADP  420
PI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360388.11e-169PREDICTED: uncharacterized protein LOC102597795
TrEMBLM1DZF31e-169M1DZF3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000968751e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128221921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.14e-18DNA-binding storekeeper protein-related transcriptional regulator